growth-inhibiting gene 27 |
Growth inhibitor from BSC-1 |
FPDTVACRTQGNFCRAGACPPTFTISGQCHGGLLNCCAKIPAQ |
||
abbr. GIF (a term with multiple meanings). This factor, called also GIFB [growth inhibitory factor brain] (Uchida et al, 1991; Kobayashi et al, 1993) or GRIF [neuronal growth inhibition factor], is found in normal human brain tissue and is expressed exclusively in the nervous system (astrocytes in gray matter). GIF is not expressed in fetal brain (Tsuji et al, 1992).
GIF has a length of 68 amino acids and shows 63 % sequence identity with human metallothionein-2 at the protein level (Uchida et al, 1991). All cysteine residues are conserved between GIF and mammalian metallothioneins
...
...
...
...
... Subscribe to continue reading!
... ...
Content view restricted ! |