glomus cells |
Glossary of Angiogenesis |
ectonucleoside triphosphate diphosphohydrolase 3 |
||
This peptide with the sequence QKNDTAFSCHFFEIYLSNCFNKEKYIKNYLQIM has been identified from salivary glands of the tsetse fly (Glossina morsitans morsitans).
Gloss 2 is an immunoregulatory peptide that has the ability to inhibit the secretion of TNF-alpha, IFN-gamma), IL6, and IL10 induced by lipopolysaccharide (LPS) in mouse splenocytes. Gloss 2 also significantly suppresses the activation of the MAPK signaling pathway induced by LPS through blocking phosphorylations of JNK, ERK and
...
...
...
...
... Subscribe to continue reading!
... ...
Content view restricted !
COPE - with 54500+ entries the most comprehensive cell-to-cell communication knowledge base