GMEB1 |
GMEM |
YAEGTFISDYSIAMDKIHQQDFVNWLLAQKGKKNDWKHNITQ |
||
[Granulomonopoietic enhancing factor] This biochemically uncharacterized factor of 74 kDa is called also GM-EA [granulomonopoietic enhancing activity]. It acts as an accessory protein that enhances the proliferation and/or maturation of the myeloid progenitor cells CFU-GM and pre-CFU-GM (see also: hematopoiesis).
In combination with other colony stimulating factors (see also: CSF) it promotes the development of colonies containing granulocytes and macrophages (see also: Colony formation assay). The factor has no effect on either erythroid (see: BFU-E) or mixed cell types (
...
...
...
...
... Subscribe to continue reading!
... ...
Content view restricted ! |