gloverin-like protein 4 |
GLP-1 neurons |
inv-TKs |
||
[glucagon-like peptide-1] GLP-1, formerly called insulinotropin (Mojsov et al, 1987), is a peptide hormone of 31 amino acids (HDEFERHAEGTFTSDVSSYLEGQAAKEFIAWLVKGRG) encoded by the preproglucagon gene. The protein corresponds to PG(78-107) [proglucagon(78-107)] (see also: Holst, 1997). Both pancreas and intestine contain GLP-1 in at least two forms of 31 amino acids (GLP-1 (7-37), 7-37, or glucagon-like peptide 1 (7-37) (HAEGTFTSDVSSYLEGQAAKEFIAWLVKGRG), and of 37 residues (GLP-1 (1-37) or glucagon-like peptide 1 (1-37) (Mojsov S et al, 1986) (see also:
...
...
...
...
... Subscribe to continue reading!
... ...
Content view restricted ! |