FRGLAKLLKIGLKSFARVLKKVLPKAAKAGKALAKSMADENAIRQQNQ |
Friend spleen focus-forming virus |
serotonergic neurons |
||
abbr. FOE. This protein has been identified by Kwiatkowski BA et al (2004) in a screen for binding partners of the Epstein-Barr virus transformation-related protein EBNA2. FOE and EBNA2 coimmunoprecipitate from lymphocyte nuclear extracts. RNA and protein blots show that FOE is expressed in all human tissues. FOE is a nuclear protein with the bulk of the protein associated with the nuclear matrix. FOE has been suggested to associate with transcriptionally active nuclear subregions in interphase cells and to concentrate at the ends of formed chromosomes during mitosis. The protein appears to be an isoform of hWAPL [wings apart-like].
... ... ... ... ... Subscribe to continue reading! ... ...
Content view restricted ! |