Fibrinogen-beta(1-42) |
Fibrinogen-beta(43-63) |
GFGCNGPWDEDDMQCHNHCKSIKGYKGGYCAKGGFVCKCY |
||
This peptide, derived from the beta subunit of fibrinogen, is being referred to also as Bbeta(15-42). It is called also FX06.
This bioactive fragment is a 28 amino acid cleavage product of fibrin. The peptide is released from fibrin E1 fragments by the action of plasmin, following fibrin formation induced by thrombin (Olexa et al, 1981; Smith et al, 1990; Walker and Nesheim, 1999). It represents a sensitive indicator of fibrinolytic activity (Fareed et al, 1998). The peptide is more than a degradation product occurring after fibrin inactivation and is seen now as a bioactive signaling molecule.
Fibrinogen-beta(15-42) has anti-inflammatory
...
...
...
...
... Subscribe to continue reading!
... ...
Content view restricted ! |