FA-1 |
Fa-AMP2 |
serum response factor accessory protein |
||
[Fagopyrum antimicrobial peptide-1] This cysteine- and glycinep-rich peptide (AQCGAQGGGATCPGGLCCSQWGWCGSTPKYCGAGCQSNCK) has been purified from the seeds of buckwheat (Fagopyrum esculentum Moench) (Fujimura et al, 2003). The peptide, which differs from Fa-AMP2 only in the terminal amino acid, belongs to the class of plant defensins and is active against plant pathogenic fungi, and Gram-positive bacteria and Gram-negative bacteria.
For other proteins/peptides with functions in innate immunity and/or antimicrobial activities see also: Innate immunity and defense peptides Dictionary.
... ... ... ... ... Subscribe to continue reading! ... ...
Content view restricted ! |