COPE Media Kit


Cope Home
Previous entry:
FSH
Next entry:
FSHA
Random entry:
MTPFWRGVSLRPIGASCRDDSECITRLCRKRRCSLSVAQE
Search COPE:

FSH33

This peptide, YTRDLVYKDPARPKIQKTCTF, corresponds to amino acids 33-53 of the beta-chain of FSH [Follicle-stimulating hormone] (FSH-beta(33-53); beta-follicle-stimulating hormone(33-53)).

Zhang et al (2009) have used this peptide as a homing peptide in nanoparticles to target the FSH receptor that is expressed in ovarian cancer. These nanoparticles home in to ovarian cancer cells with high selectivity. Nanoparticles loaded with the anticancer drug paclitaxel display stronger antiproliferation and antitumor effects compared with free drug or naked drug-loaded nanoparticles both in vitro and in vivo.

Hong et al (2013) have used FSH33 nanoparticles to deliver siRNA ... ... ... ... ... Subscribe to continue reading! ... ...

 

Content view restricted !

COPE - with 54500+ entries the most comprehensive cell-to-cell communication knowledge base

Extensive In-depth and In Context Information covering terminology, nomenclature, concepts, strategies & complexities of cellular communication, including Acute phase proteins | Angiogenesis | Antimicrobial & host defense peptides | Apoptosis & other forms of cell death | CD antigens | Cell lines | Cell reprogramming | Chemokines | Cryptides | Cytokines & Growth factors | CytokineTopics | Eukaryotic cell types & expression profiles | Hematopoiesis | Hormones | Inflamation & inflammatory mediators | Innate Immunity | Metalloproteinases | Microvesicles / Microparticles | Moonlighting proteins & cryptides | Neuropeptides | Non-coding RNAs | Pathogenicity & Virulence Factors | Pattern recognition receptors | Peptide sequences | Protein domains | Regulatory peptide factors | Viroceptors | Virokines and more.

Full COPEing for subscribers:

Access to Alphabet bar, Freetext search, Leafing/browsing functions, Internal Backlinking, Topic-specific introductions, Topic-specific integrated subdictionaries, Scientific references with PubMed links

with a 15 USD/month subscription at Cells-Talk.com

See example pages at the bottom of the Cells-Talk.com home page
THE SMART ONES COPE
The others just sisyphos around

 

Copyright © 1997-2021. All rights reserved by Dr H Ibelgaufts, the author of COPE - Cytokines & Cells Online Pathfinder Encyclopaedia

ENTRY LAST MODIFIED: May 2015



 
 
SUPPORT COPE | Intro | Subdictionaries | New Entries | Contribute data | COPE Credentials
# A B C D E F G H I J K L M N O P Q R S T U V W X Y Z

              Created, developed, and maintained by Dr H Ibelgaufts              
About the author of COPE
  |    Contact COPE   |    Terms & Conditions


U L T R A   P O S S E    N E M O   O B L I G A T U R



cope.cgi Version 1.41 [08.12.2020]. (c) JI. Powered by Perl 5.032001. key=19820