FSH |
FSHA |
MTPFWRGVSLRPIGASCRDDSECITRLCRKRRCSLSVAQE |
||
This peptide, YTRDLVYKDPARPKIQKTCTF, corresponds to amino acids 33-53 of the beta-chain of FSH [Follicle-stimulating hormone] (FSH-beta(33-53); beta-follicle-stimulating hormone(33-53)).
Zhang et al (2009) have used this peptide as a homing peptide in nanoparticles to target the FSH receptor that is expressed in ovarian cancer. These nanoparticles home in to ovarian cancer cells with high selectivity. Nanoparticles loaded with the anticancer drug paclitaxel display stronger antiproliferation and antitumor effects compared with free drug or naked drug-loaded nanoparticles both in vitro and in vivo.
Hong et al (2013) have used FSH33 nanoparticles to deliver siRNA
...
...
...
...
... Subscribe to continue reading!
... ...
Content view restricted ! |