EKD |
EKGYSDCAWEIVRVEMMRALTSSTTLQKRLTKTGGDLNSP |
Rig1 |
||
[Epidermal keratinocyte-derived basophil promoting activity] This activity is found in the conditioned medium of human keratinocytes. It promotes the growth of early myeloid cells, in particular the development of basophils (see also: hematopoiesis). Some of the activity is due to IL3 and some to a soluble form of the cell surface antigen CD23 (Dalloul et al, 1992).
... ... ... ... ... Subscribe to continue reading! ... ...
Content view restricted ! |