duck basic protein small 2 |
Duck BPS2 |
relaxin H1 |
||
[duck basic protein small 1] abbr. dBPS1. This protein (QKKGFCAGYCSYSCAKTDEWTFHQTCGKMYCCIPPPKKG) has been identified in duck (Anas platyrhynchos) egg white (Naknukool et al, 2008). The peptide is related to Meleagrin and Cygnin and has been grouped as a member of a family of avian proteins related to Beta-Defensins, referred to as ovodefensins (Gong et al, 2010). It is not known whether the peptide plays a role in host defense as direct antibacterial activity has not been demonstrated.
Naknukool S et al (2011) have reported that DUCK BPS1 associates with RNA. The peptide
...
...
...
...
... Subscribe to continue reading!
... ...
Content view restricted ! |