Drosophila melanogaster bithorax |
Drosophila melanogaster Diptericin |
p17 |
||
This Drosophila melanogaster antimicrobial peptide (ATCDLLSKWNWNHTACAGHCIAKGFKGGYCNDKAVCVCRN), encoded by gene CG1385, shows sequence similarities with defensins from mammalian neutrophils and macrophages. Expression is induced by bacterial challenge with kinetics of an acute phase protein. The protein is expressed also in the absence of immune challenge during metamorphosis (Dimarcq et al, 1994).
Brennan et al (2007) have shown that induction of Defensin in the fat body during infection requires phagocytic blood cells for detecting infection and activating humoral immune responses. They have identified Psidin, encoded by gene
...
...
...
...
... Subscribe to continue reading!
... ...
Content view restricted ! |