COPE Media Kit


Cope Home
Previous entry:
DS5
Next entry:
DSD-1 PG
Random entry:
CTTGPCCRQCKLKPAGTTCWKTSRTSHYCTGKSCDCPSYPG
Search COPE:

DSCAM

[Down syndrome cell adhesion molecule] Human DSCAM is a protein belonging to the immunoglobulin superfamily family. DSCAM is a type-1 transmembrane receptor that contains ten immunoglobulin domains and six fibronectin type-3 repeats in its extracellular domain (Yamakawa et al, 1998). It is overexpressed in the brains of Down syndrome patients and implicated in mental retardation (Saito et al, 2000). Xu Y et al (2011) have reported that mammalian DSCAM deletion in the mouse causes severe hydrocephalus, decreases motor function, and impairs motor learning ability, indicating that mammalian DSCAM gene is critical for the formation of the central nervous system. Fuerst et al (2008) have reported that DSCAM is required for neurite arborization and mosaic spacing in the ... ... ... ... ... Subscribe to continue reading! ... ...

 

Content view restricted !

COPE - with 54500+ entries the most comprehensive cell-to-cell communication knowledge base

Extensive In-depth and In Context Information covering terminology, nomenclature, concepts, strategies & complexities of cellular communication, including Acute phase proteins | Angiogenesis | Antimicrobial & host defense peptides | Apoptosis & other forms of cell death | CD antigens | Cell lines | Cell reprogramming | Chemokines | Cryptides | Cytokines & Growth factors | CytokineTopics | Eukaryotic cell types & expression profiles | Hematopoiesis | Hormones | Inflamation & inflammatory mediators | Innate Immunity | Metalloproteinases | Microvesicles / Microparticles | Moonlighting proteins & cryptides | Neuropeptides | Non-coding RNAs | Pathogenicity & Virulence Factors | Pattern recognition receptors | Peptide sequences | Protein domains | Regulatory peptide factors | Viroceptors | Virokines and more.

Full COPEing for subscribers:

Access to Alphabet bar, Freetext search, Leafing/browsing functions, Internal Backlinking, Topic-specific introductions, Topic-specific integrated subdictionaries, Scientific references with PubMed links

with a 15 USD/month subscription at Cells-Talk.com

See example pages at the bottom of the Cells-Talk.com home page
THE SMART ONES COPE
The others just sisyphos around

 

Copyright © 1997-2021. All rights reserved by Dr H Ibelgaufts, the author of COPE - Cytokines & Cells Online Pathfinder Encyclopaedia

ENTRY LAST MODIFIED: August 2013



 
 
SUPPORT COPE | Intro | Subdictionaries | New Entries | Contribute data | COPE Credentials
# A B C D E F G H I J K L M N O P Q R S T U V W X Y Z

              Created, developed, and maintained by Dr H Ibelgaufts              
About the author of COPE
  |    Contact COPE   |    Terms & Conditions


U L T R A   P O S S E    N E M O   O B L I G A T U R



cope.cgi Version 1.41 [08.12.2020]. (c) JI. Powered by Perl 5.028001. key=15833