DLRAICAGAHAL |
DLRFLYPRGKLPVPTLPPFNPKPIYIDMGNRY |
CXCL9(74-93) |
||
This peptide is one of the bioactive fragments of hemoglobin of the bivalve shellfish Arca inflata. See: hemocidins.
For other proteins (or fragments thereof) with at least one additional activity that differs from the established 'classical' activity of the parent protein see also: Dual identity proteins and Cryptides MiniCOPE Dictionary.
For other proteins/peptides with functions in innate immunity and/or antimicrobial activities see also: Innate immunity and defense peptides Dictionary.
... ... ... ... ... Subscribe to continue reading! ... ...
Content view restricted ! |