B-fibronectin |
BFL-1 |
SRTHRHSMEIRTPDINPAWYASRGIRPVGRF |
||
[BCL2 family kin] The approved gene symbol for Bfk is BCL2L15 [BCL2-like-15]. In databanks the designation C1orf178 [chromosome 1 open reading frame 178] is used also.
This cytosolic protein is a member of the BCL2 protein family (Coultas et al, 2003). It contains a BH2 domain and a NH3 domain, but no BH1 domain or BH4 domain. The protein is most closely related to BCLgL. The protein does not bind to other members of the BCL2 family but, through its BH3 domain
...
...
...
...
... Subscribe to continue reading!
... ...
Content view restricted ! |