Ataxia-Telangiectasia group D-Complementing protein |
ATCDLLSPFKVGHAACAAHCIARGKRGGWCDKRAVCNCRK |
Fibroblast growth factor-12b |
||
The Arabidopsis thaliana gene homologous with BI-1 (BAX inhibitor-1), a protein counteracting cell death induced by apoptosis induced by BAX (Kawai-Yamada et al, 2001; Sanchez et al, 2000).
For other entries pertaining to cell death mechanisms see also the Apoptosis and Cell Death Dictionary section of this encyclopedia.
... ... ... ... ... Subscribe to continue reading! ... ...
Content view restricted ! |