Anti-CD3 induced cytokine-related syndrome |
Anti-death protein |
AMWKDVLKKIGTVALHAGKAALGAVADTISQ |
||
[anti-cytokine]
a general name given to a family of biological response modifiers that interfere with the biological functions of cytokines. These agents include soluble receptors and inhibitors of cytokine actions such as IL1ra (Interleukin-1 receptor antagonist).
For other relevant entries see also the Pathogenicity/Virulence Factors Dictionary section of this encyclopedia.
... ... ... ... ... Subscribe to continue reading! ... ...
Content view restricted ! |