Angiopoietin-1 |
Angiopoietin-3 |
GFWDTIKQAGKKFFLNVLDKIRCKVAGGCRT |
||
abbr. Ang-2, ANGPT2. Angiopoietin-2 (496 amino acids) is related to Angiopoietin-1 and was identified by homology screening (Maisonpierre et al, 1997). The human gene has been mapped to chromosome 8p23 (Cheung et al, 1998). Several Angiopoietin-2 isoforms with truncated amino-terminal domains arising by alternative splicing have been described. Ang-2[443] is expressed in primary endothelial cells, several nonendothelial tumor cell lines, and some primary tumor tissues and its mRNA is upregulated temporarily during macrophage differentiation (Kim et al, 2000). This truncated protein binds to the TIE-2 receptor but not to TIE-1 and partially inhibits
...
...
...
...
... Subscribe to continue reading!
... ...
Content view restricted ! |