Ala-Ser-Asp-Trp-Asn-Arg-Leu-Ser-Gly-Met-Trp |
Ala-Ser-Phe-Ser-Pro-Trp-Glyamide |
SRWPSPGRPRPFPGRPKPIFRPRPCNCYAPPCPCDRWRH |
||
(ASHLPSDFTPAVHASL); this peptide corresponds to HbA(110-125). See: hemoglobin.
See also cryptides for bioactive fragments of parent proteins. For other proteins (or fragments thereof) with at least one additional activity that differs from the established 'classical' activity of the parent protein see also: Dual identity proteins and Cryptides MiniCOPE Dictionary.
See also: hormones/neuropeptide MiniCOPE dictionary for hormonally active proteins, peptides, neuropeptides, regulatory peptides, prohormones and their receptors.
For other entries pertaining to peptides that are usually not classified as cytokines or
...
...
...
...
... Subscribe to continue reading!
... ...
Content view restricted ! |