APPGRSDVYPPPLGSEHNGQVAEDAVSRPKDDSVPEV |
appican |
a disintegrin and metalloprotease domain 29 |
||
This peptide corresponds to VGF(24-64). See: neurosecretory protein VGF.
See also: hormones/neuropeptide MiniCOPE dictionary for hormonally active proteins, peptides, neuropeptides, regulatory peptides, prohormones and their receptors.
For other proteins (or fragments thereof) with at least one additional activity that differs from the established 'classical' activity of the parent protein see also: Dual identity proteins and Cryptides MiniCOPE Dictionary.
... ... ... ... ... Subscribe to continue reading! ... ...
Content view restricted ! |