APOC1(64-88) |
Apoceruloplasmin |
NEPVSCIRNGGICQYRCIGLRHKIGTCGSPFKCCK |
||
[apolipoprotein C1(67-88)] This peptide, KTRNWFSEHFKKVKEKLKDTFA, identified by Bishop et al (2015) in the plasma of the American alligator, Alligator mississippiensis, has been termed Apo6 by by Barksdale et al (2016). APOC1(67-88) is an antimicrobial peptide derived from apolipoprotein C1 and shows strong in vitro activity against multi-drug resistant and clinically isolated strains of Staphylococcus aureus, Escherichia coli, Pseudomonas aeruginosa, and Acinetobacter baumannii.
For other proteins/peptides with functions in innate immunity and/or antimicrobial activities see also: Innate immunity and defense peptides Dictionary.
...
...
...
...
... Subscribe to continue reading!
... ...
Content view restricted ! |