A1 cells |
A1-Pancortins |
Chlamydia protein Associating with Death Domains |
||
[alpha-1-antiproteinase(394-428); alpha-1-antitrypsin(394-428)] This is a C-terminal fragment, PPPVIKFNRPFLMWWIVERDTRSILFMGKIVNPKAP, of alpha-1-antiproteinase (alpha-1-antitrypsin) identified by Bishop et al, 2015) in the plasma of Alligator mississippiensis. The peptide, also: SERPINA1(394-428), shows significant activity against Escherichia coli, Bacillus cereus, Staphylococcus aureus, and exhibit moderate activity against Pseudomonas aeruginosa (Bishop et al, 2015; Barksdale et al, 2016).
For another bioactive fragment of alpha-1-antitrypsin see: alpha-1-antitrypsin(353-372).
For other proteins/peptides with functions in innate immunity
...
...
...
...
... Subscribe to continue reading!
... ...
Content view restricted ! |