5,12,18R-trihydroxy-EPA |
a |
GFQWVTGDNNTSYSRWARLDLNGAPLCGPLC |
||
A 100 kDa biglycan-like protein isolated from rat thymic myoid 871207B-cells. The factor is not found in the conditioned medium or extracts of L929 cells (Kikuchi et al, 1995).
The factor, termed hematopoietic biglycan, is a proteoglycan (see also: extracellular matrix) consisting of a core protein with an apparent molecular mass of 40 kDa, a 50 kDa chondroitin sulphate chain and 10 kDa N-linked oligosaccharide chains. A small amount of the 40 kDa protein is found also in conditioned medium of the 871207B-cells.
The 100 kDa factor and also the secreted 40 kDa core protein induce proliferation and differentiation of bone marrow cells (see also:
...
...
...
...
... Subscribe to continue reading!
... ...
Content view restricted ! |