COPE Media Kit


Cope Home
Previous entry:
(2E,6E)-Farnesyl Diphosphate Synthase
Next entry:
2E-cyano-3-(3,4-dihydroxyphenyl)-N-phenyl-2-propenamide
Random entry:
GFGCPNNYQCHRHCKSIPGRCGGYCGGWHRLRCTCYRC
Search COPE:

2E8

(ATCC TIB-239 2E8) This stromal cell dependent pre-B-cell clone has been described by Ishihara et al (1991). 2E8 have been propagated for more than 1 year in the presence of IL7 alone and is selectively responsive to that cytokine.

2E8 cells depend on IL7 for growth and survival and can be used as an indicator cell line for detecting and quantitating this factor (see also: bioassays, cytokine assays). 2E8 cells respond to human or murine IL7, but the latter has been suggested to be preferable for routine passage and maintenance.

The growth of 2E8 cells in methylcellulose assays (see also: ... ... ... ... ... Subscribe to continue reading! ... ...

 

Content view restricted !

COPE - with 54500+ entries the most comprehensive cell-to-cell communication knowledge base

Extensive In-depth and In Context Information covering terminology, nomenclature, concepts, strategies & complexities of cellular communication, including Acute phase proteins | Angiogenesis | Antimicrobial & host defense peptides | Apoptosis & other forms of cell death | CD antigens | Cell lines | Cell reprogramming | Chemokines | Cryptides | Cytokines & Growth factors | CytokineTopics | Eukaryotic cell types & expression profiles | Hematopoiesis | Hormones | Inflamation & inflammatory mediators | Innate Immunity | Metalloproteinases | Microvesicles / Microparticles | Moonlighting proteins & cryptides | Neuropeptides | Non-coding RNAs | Pathogenicity & Virulence Factors | Pattern recognition receptors | Peptide sequences | Protein domains | Regulatory peptide factors | Viroceptors | Virokines and more.

Full COPEing for subscribers:

Access to Alphabet bar, Freetext search, Leafing/browsing functions, Internal Backlinking, Topic-specific introductions, Topic-specific integrated subdictionaries, Scientific references with PubMed links

with a 15 USD/month subscription at Cells-Talk.com

See example pages at the bottom of the Cells-Talk.com home page
THE SMART ONES COPE
The others just sisyphos around

 

Copyright © 1997-2021. All rights reserved by Dr H Ibelgaufts, the author of COPE - Cytokines & Cells Online Pathfinder Encyclopaedia

ENTRY LAST MODIFIED: March 2002



 
 
SUPPORT COPE | Intro | Subdictionaries | New Entries | Contribute data | COPE Credentials
# A B C D E F G H I J K L M N O P Q R S T U V W X Y Z

              Created, developed, and maintained by Dr H Ibelgaufts              
About the author of COPE
  |    Contact COPE   |    Terms & Conditions


U L T R A   P O S S E    N E M O   O B L I G A T U R



cope.cgi Version 1.41 [08.12.2020]. (c) JI. Powered by Perl 5.032001. key=34